PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof015428
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family MYB_related
Protein Properties Length: 198aa    MW: 20638.1 Da    PI: 10.4486
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Saccharum_officinarum-257133727PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.75.4e-132569347
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +WT++E+ l++ + +++G+g+W++I+r +   Rt+ q+ s+ qky
        Sof015428 25 AWTEDEHRLFLLGLEKYGKGDWRSISRNFVISRTPTQVASHAQKY 69
                     6*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.6051874IPR017930Myb domain
SuperFamilySSF466899.72E-172075IPR009057Homeodomain-like
SMARTSM007179.3E-112272IPR001005SANT/Myb domain
TIGRFAMsTIGR015571.4E-172272IPR006447Myb domain, plants
PfamPF002491.7E-112569IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.0E-112568IPR009057Homeodomain-like
CDDcd001676.68E-112570No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
GGGGGTHGDK GSSKSAEQER RKGIAWTEDE HRLFLLGLEK YGKGDWRSIS RNFVISRTPT  60
QVASHAQKYF IRLNSMNRER RRSSIHDITS VNNGDASTAQ GPITGQTNGQ AANPGKPSKQ  120
SPQPANTPPG VDAYGTTIGQ PVGGPLVSAV GTPVTLPVSA PPHLAYGMHA PVPGAVVPGA  180
PVNIAPMPYP MPPPSSHG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.26650.0bud| crown| inflorescence| leaf| meristem| root| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002448771.11e-142hypothetical protein SORBIDRAFT_06g032880
TrEMBLC5YAI21e-142C5YAI2_SORBI; Putative uncharacterized protein Sb06g032880
STRINGSb06g032880.11e-141(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.16e-67MYB family protein